![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
![]() | Protein automated matches [190777] (27 species) not a true protein |
![]() | Species Methanosarcina mazei [TaxId:192952] [354310] (4 PDB entries) |
![]() | Domain d5xv5b_: 5xv5 B: [354317] Other proteins in same PDB: d5xv5a2, d5xv5d2 automated match to d2azna1 mutant |
PDB Entry: 5xv5 (more details), 2.5 Å
SCOPe Domain Sequences for d5xv5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xv5b_ c.71.1.0 (B:) automated matches {Methanosarcina mazei [TaxId: 192952]} mdrpfifinsamsadgklstkerkqvkisgkldfermdelrahadaimvgigtvladdps ltvksperkaarkaagksenpvrvvvdesartplnadifkkgeglriiavsnsapeekir mleekalviktgafrvdltelaaklkemginslmveggatlnwgmlsaglvdevytfvgn liiggktaptftdgegftenellglelssaekiedgillkwkvk
Timeline for d5xv5b_: