Class b: All beta proteins [48724] (180 folds) |
Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
Superfamily b.68.1: Sialidases [50939] (3 families) |
Family b.68.1.0: automated matches [191452] (1 protein) not a true family |
Protein automated matches [190692] (20 species) not a true protein |
Species Unidentified influenza virus [TaxId:11309] [354282] (4 PDB entries) |
Domain d5nznc_: 5nzn C: [354314] automated match to d5huga_ complexed with ca, edo, g39, nag; mutant |
PDB Entry: 5nzn (more details), 1.73 Å
SCOPe Domain Sequences for d5nznc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nznc_ b.68.1.0 (C:) automated matches {Unidentified influenza virus [TaxId: 11309]} svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpnngqasykifriekg kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs sisfcgvnsdtvgwswpdgaelpftid
Timeline for d5nznc_: