Lineage for d5nznc_ (5nzn C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2807607Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 2808129Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 2808130Protein automated matches [190692] (20 species)
    not a true protein
  7. 2808334Species Unidentified influenza virus [TaxId:11309] [354282] (4 PDB entries)
  8. 2808341Domain d5nznc_: 5nzn C: [354314]
    automated match to d5huga_
    complexed with ca, edo, g39, nag; mutant

Details for d5nznc_

PDB Entry: 5nzn (more details), 1.73 Å

PDB Description: complex of h275y/s247n mutant variant of neuraminidase from h1n1 influenza virus with oseltamivir
PDB Compounds: (C:) Neuraminidase

SCOPe Domain Sequences for d5nznc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nznc_ b.68.1.0 (C:) automated matches {Unidentified influenza virus [TaxId: 11309]}
svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpnngqasykifriekg
kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
sisfcgvnsdtvgwswpdgaelpftid

SCOPe Domain Coordinates for d5nznc_:

Click to download the PDB-style file with coordinates for d5nznc_.
(The format of our PDB-style files is described here.)

Timeline for d5nznc_: