Lineage for d5nweb_ (5nwe B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. Protein automated matches [190692] (20 species)
    not a true protein
  7. Species Influenza A virus, different strains [TaxId:11320] [188445] (32 PDB entries)
  8. Domain d5nweb_: 5nwe B: [354308]
    automated match to d5huga_
    complexed with ca, g39, nag; mutant

Details for d5nweb_

PDB Entry: 5nwe (more details), 2 Å

PDB Description: complex of h275y mutant variant of neuraminidase from h1n1 influenza virus with oseltamivir
PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d5nweb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nweb_ b.68.1.0 (B:) automated matches {Influenza A virus, different strains [TaxId: 11320]}
svklagnsslcpvsgwaiyskdnsvrigskgdvfvirepfiscsplecrtffltqgalln
dkhsngtikdrspyrtlmscpigevpspynsrfesvawsasachdginwltigisgpdng
avavlkyngiitdtikswrnnilrtqesecacvngscftvmtdgpsngqasykifriekg
kivksvemnapnyyyeecscypdsseitcvcrdnwhgsnrpwvsfnqnleyqigyicsgi
fgdnprpndktgscgpvssngangvkgfsfkygngvwigrtksissrngfemiwdpngwt
gtdnnfsikqdivginewsgysgsfvqhpeltgldcirpcfwvelirgrpkentiwtsgs
sisfcgvnsdtvgwswpdgaelpftidk

SCOPe Domain Coordinates for d5nweb_ are not available.

Timeline for d5nweb_:

Domains from other chains:
(mouse over for more information)
d5nwea_, d5nwec_, d5nwed_