Lineage for d6fe0d_ (6fe0 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2811457Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 2811458Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 2812758Family b.74.1.0: automated matches [191576] (1 protein)
    not a true family
  6. 2812759Protein automated matches [191011] (16 species)
    not a true protein
  7. 2812843Species Human (Homo sapiens) [TaxId:9606] [188766] (28 PDB entries)
  8. 2812879Domain d6fe0d_: 6fe0 D: [354297]
    automated match to d1hcba_
    complexed with v90, zn

Details for d6fe0d_

PDB Entry: 6fe0 (more details), 1.91 Å

PDB Description: three dimensional structure of human carbonic anhydrase ix in complex with benzenesulfonamide.
PDB Compounds: (D:) Carbonic anhydrase 9

SCOPe Domain Sequences for d6fe0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fe0d_ b.74.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnnghsvqltlppglem
algpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafarvdealgrpggl
avlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsdfsryfqyegslt
tppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqplngrvieasfp

SCOPe Domain Coordinates for d6fe0d_:

Click to download the PDB-style file with coordinates for d6fe0d_.
(The format of our PDB-style files is described here.)

Timeline for d6fe0d_: