Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Amycolatopsis sp. [TaxId:385957] [354294] (24 PDB entries) |
Domain d5omsa_: 5oms A: [354295] automated match to d3nc5a_ complexed with 261, hem |
PDB Entry: 5oms (more details), 1.95 Å
SCOPe Domain Sequences for d5omsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5omsa_ a.104.1.0 (A:) automated matches {Amycolatopsis sp. [TaxId: 385957]} erpdlawldevtmtqlernpyevyerlraeaplafvpvlgsyvastaevcrevatspdfe avitpaggrtfghpaiigvngdihadlrsmvepalqpaevdrwiddlvrpiarrylerfe ndghaelvaqycepvsvrslgdllglqevdsdklrewfaklnrsftnaavdengefanpe gfaegdqakaeiravvdplidkwiehpddsaishwlhdgmppgqtrdreyiyptiyvyll gamqepghgmastlvglfsrpeqleevvddptlipraiaeglrwtspiwsataristkpv tiagvdlpagtpvmlsygsanhdtgkyeapsqydlhrpplphlafgagnhacagiyfanh vmrialeelfeaipnlerdtregvefwgwgfrgptslhvtwev
Timeline for d5omsa_: