SCOPe 2.07: Domain d5wcqg_: 5wcq G:

Lineage for d5wcqg_ (5wcq G:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
   automatically mapped to Pfam PF02126

6. Protein automated matches [190258] (3 species)
   not a true protein

7. Species Brevundimonas diminuta [TaxId:293] [194088] (25 PDB entries)

8. Domain d5wcqg_: 5wcq G: [354293]
   automated match to d1qw7a_
   complexed with cac, mpd, zn

Details for d5wcqg_

PDB Entry: 5wcq, 1.58 Å

PDB Description: phosphotriesterase variant s2

PDB Compounds: (G:) Phosphotriesterase variant PTE-R1

SCOPe Domain Sequences for d5wcqg_:

Sequence; same for both SEQRES and ATOM records:

>d5wcqg_ c.1.9.3 (G:) automated matches {Brevundimonas diminuta [TaxId: 293]}
gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
gvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflre
iqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqa
aifeseglspsrvcighsddtddlsyltalaargyligldsiphsaiglednasasallg
irswqtrallikalidqgytkqilvsndwlfgissyvtnimdvmdsvnpdgmafiplrvi
pflrekgipqetlagitvtnparflsptl

Timeline for d5wcqg_:

• d5wcqg_ is new in SCOPe 2.07-stable
  
• d5wcqg_ appears in the current release, SCOPe 2.08