Lineage for d1jdyb1 (1jdy B:1-190)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910122Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2910123Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2910124Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins)
  6. 2910167Protein Phosphoglucomutase, N-terminal domain [419006] (1 species)
  7. 2910168Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [419478] (6 PDB entries)
  8. 2910172Domain d1jdyb1: 1jdy B:1-190 [35429]
    Other proteins in same PDB: d1jdya2, d1jdya3, d1jdya4, d1jdyb2, d1jdyb3, d1jdyb4
    complexed with cd, so4
    has additional insertions and/or extensions that are not grouped together

Details for d1jdyb1

PDB Entry: 1jdy (more details), 2.7 Å

PDB Description: rabbit muscle phosphoglucomutase
PDB Compounds: (B:) phosphoglucomutase

SCOPe Domain Sequences for d1jdyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdyb1 c.84.1.1 (B:1-190) Phosphoglucomutase, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
vkivtvktkaypdqkpgtsglrkrvkvfqsstnyaenfiqsiistvepaqrqeatlvvgg
dgrfymkeaiqlivriaaangigrlvigqngilstpavsciirkikaiggiiltashnpg
gpngdfgikfnisnggpapeaitdkifqisktieeyaicpdlkvdlgvlgkqqfdlenkf
kpftveivds

SCOPe Domain Coordinates for d1jdyb1:

Click to download the PDB-style file with coordinates for d1jdyb1.
(The format of our PDB-style files is described here.)

Timeline for d1jdyb1: