SCOPe 2.08: Domain d6fzvd1: 6fzv D:8-125

Lineage for d6fzvd1 (6fzv D:8-125)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.23: CUB-like [49853] (3 superfamilies)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families)
   automatically mapped to Pfam PF00431

5. Family b.23.1.0: automated matches [254288] (1 protein)
   not a true family

6. Protein automated matches [254671] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255797] (4 PDB entries)

8. Domain d6fzvd1: 6fzv D:8-125 [354280]
   automated match to d5cisa3
   complexed with ca, cl, flc

Details for d6fzvd1

PDB Entry: 6fzv, 2.7 Å

PDB Description: crystal structure of the metalloproteinase enhancer pcpe-1 bound to the procollagen c propeptide trimer (short)

PDB Compounds: (D:) Procollagen C-endopeptidase enhancer 1

SCOPe Domain Sequences for d6fzvd1:

Sequence; same for both SEQRES and ATOM records:

>d6fzvd1 b.23.1.0 (D:8-125) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvflcggdvkgesgyvasegfpnlyppnkeciwtitvpegqtvslsfrvfdlelhpacry
dalevfagsgtsgqrlgrfcgtfrpaplvapgnqvtlrmttdegtggrgfllwysgra

Timeline for d6fzvd1:

• d6fzvd1 first appeared in SCOPe 2.07