Lineage for d6fnca_ (6fnc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332674Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2333633Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
    automatically mapped to Pfam PF00244
  5. 2333634Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)
  6. 2333653Protein zeta isoform [48449] (2 species)
  7. 2333663Species Human (Homo sapiens) [TaxId:9606] [48451] (12 PDB entries)
  8. 3054215Domain d6fnca_: 6fnc A: [354277]
    automated match to d2o02a_
    complexed with bez, ca, cl, dwk, gol

Details for d6fnca_

PDB Entry: 6fnc (more details), 2.12 Å

PDB Description: mono- and bivalent 14-3-3 inhibitors for characterizing supramolecular lysine-peg interactions in proteins
PDB Compounds: (A:) 14-3-3 protein zeta/delta

SCOPe Domain Sequences for d6fnca_:

Sequence, based on SEQRES records: (download)

>d6fnca_ a.118.7.1 (A:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

Sequence, based on observed residues (ATOM records): (download)

>d6fnca_ a.118.7.1 (A:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlsykdstlimqllrdnltlwts

SCOPe Domain Coordinates for d6fnca_:

Click to download the PDB-style file with coordinates for d6fnca_.
(The format of our PDB-style files is described here.)

Timeline for d6fnca_:

  • d6fnca_ is new in SCOPe 2.07-stable