![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.74: Carbonic anhydrase [51068] (1 superfamily) single sheet; 10 strands |
![]() | Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) ![]() |
![]() | Family b.74.1.0: automated matches [191576] (1 protein) not a true family |
![]() | Protein automated matches [191011] (16 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188766] (28 PDB entries) |
![]() | Domain d6fe2a_: 6fe2 A: [354266] automated match to d1hcba_ complexed with zn |
PDB Entry: 6fe2 (more details), 1.87 Å
SCOPe Domain Sequences for d6fe2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fe2a_ b.74.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} wryggdppwprvspacagrfqspvdirpqlaafspalrplellgfqlpplpelrlrnngh svqltlppglemalgpgreyralqlhlhwgaagrpgsehtveghrfpaeihvvhlstafa rvdealgrpgglavlaafleegpeensayeqllsrleeiaeegsetqvpgldisallpsd fsryfqyegslttppcaqgviwtvfnqtvmlsakqlhtlsdtlwgpgdsrlqlnfratqp lngrvieasfp
Timeline for d6fe2a_: