Lineage for d6ds2c_ (6ds2 C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2323235Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2323236Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2323269Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2323270Protein Calcyclin (S100) [47479] (17 species)
  7. 2323333Species Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId:9606] [47487] (8 PDB entries)
    Migration inhibitory factor-related protein 8
  8. 2323352Domain d6ds2c_: 6ds2 C: [354256]
    Other proteins in same PDB: d6ds2b_, d6ds2d_, d6ds2f_, d6ds2h_
    automated match to d1xk4a1
    complexed with na, ni

Details for d6ds2c_

PDB Entry: 6ds2 (more details), 2.1 Å

PDB Description: crystal structure of ni(ii)-bound human calprotectin
PDB Compounds: (C:) Protein S100-A8

SCOPe Domain Sequences for d6ds2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ds2c_ a.39.1.2 (C:) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]}
mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
ntdgavnfqeflilvikmgvaahkkshee

SCOPe Domain Coordinates for d6ds2c_:

Click to download the PDB-style file with coordinates for d6ds2c_.
(The format of our PDB-style files is described here.)

Timeline for d6ds2c_: