Lineage for d6f2xa_ (6f2x A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490779Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2490780Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2491513Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2491514Protein automated matches [190447] (53 species)
    not a true protein
  7. 3054191Species Mycobacterium tuberculosis [TaxId:83332] [354253] (1 PDB entry)
  8. 3054192Domain d6f2xa_: 6f2x A: [354254]
    automated match to d3mc1b_

Details for d6f2xa_

PDB Entry: 6f2x (more details)

PDB Description: structural characterization of the mycobacterium tuberculosis protein tyrosine kinase a (ptka)
PDB Compounds: (A:) Protein Tyrosine Kinase A

SCOPe Domain Sequences for d6f2xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6f2xa_ c.108.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
gespqlvifdldgtltdsargivssfrhalnhigapvpegdlathivgppmhetlramgl
gesaeeaivayradysargwamnslfdgigplladlrtagvrlavatskaeptarrilrh
fgieqhfeviagastdgsrgskvdvlahalaqlrplperlvmvgdrshdvdgaaahgidt
vvvgwgygradfidktsttvvthaatidelrealgv

SCOPe Domain Coordinates for d6f2xa_:

Click to download the PDB-style file with coordinates for d6f2xa_.
(The format of our PDB-style files is described here.)

Timeline for d6f2xa_:

  • d6f2xa_ appears in periodic updates to SCOPe 2.07 starting on 2018-07-05