Lineage for d1c47b3 (1c47 B:304-420)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2159229Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2159230Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2159231Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 2159246Protein Phosphoglucomutase [53740] (1 species)
  7. 2159247Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries)
  8. 2159265Domain d1c47b3: 1c47 B:304-420 [35425]
    Other proteins in same PDB: d1c47a4, d1c47b4
    complexed with cd, g16

Details for d1c47b3

PDB Entry: 1c47 (more details), 2.7 Å

PDB Description: binding driven structural changes in crystaline phosphoglucomutase associated with chemical reaction
PDB Compounds: (B:) alpha-d-glucose 1,6-bisphosphate phosphotransferase

SCOPe Domain Sequences for d1c47b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c47b3 c.84.1.1 (B:304-420) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkffgn
lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg

SCOPe Domain Coordinates for d1c47b3:

Click to download the PDB-style file with coordinates for d1c47b3.
(The format of our PDB-style files is described here.)

Timeline for d1c47b3: