Lineage for d6dpyb_ (6dpy B:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. Protein AMPC beta-Lactamase, class C [56618] (4 species)
    contains small alpha+beta subdomain inserted in the common fold
  7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (115 PDB entries)
  8. Domain d6dpyb_: 6dpy B: [354247]
    automated match to d1my8a_
    complexed with h7a

Details for d6dpyb_

PDB Entry: 6dpy (more details), 1.91 Å

PDB Description: x-ray crystal structure of ampc beta-lactamase with inhibitor
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d6dpyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dpyb_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

SCOPe Domain Coordinates for d6dpyb_ are not available.

Timeline for d6dpyb_:

Domains from other chains:
(mouse over for more information)
d6dpya_