Lineage for d6bvte_ (6bvt E:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. Protein automated matches [190220] (14 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [272712] (16 PDB entries)
  8. Domain d6bvte_: 6bvt E: [354246]
    automated match to d1un0b_

Details for d6bvte_

PDB Entry: 6bvt (more details), 2.5 Å

PDB Description: importin alpha 1 in cargo free state
PDB Compounds: (E:) Importin subunit alpha-1

SCOPe Domain Sequences for d6bvte_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bvte_ a.118.1.0 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gtvnwsvedivkginsnnlesqlqatqaarkllsrekqppidniiraglipkfvsflgkt
dcspiqfesawaltniasgtseqtkavvdggaipafisllasphahiseqavwalgniag
dgsafrdlvikhgaidpllallavpdlstlacgylrnltwtlsnlcrnknpappldaveq
ilptlvrllhhndpevladscwaisyltdgpneriemvvkkgvvpqlvkllgatelpivt
palraignivtgtdeqtqkvidagalavfpslltnpktniqkeatwtmsnitagrqdqiq
qvvnhglvpflvgvlskadfktqkeaawaitnytsggtveqivylvhcgiieplmnllsa
kdtkiiqvildaisnifqaaeklgeteklsimieecggldkiealqrhenesvykaslnl
iekyfs

SCOPe Domain Coordinates for d6bvte_ are not available.

Timeline for d6bvte_: