Lineage for d6dpuf1 (6dpu F:1-245)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445466Species Pig (Sus scrofa) [TaxId:9823] [278808] (24 PDB entries)
  8. 3054161Domain d6dpuf1: 6dpu F:1-245 [354223]
    Other proteins in same PDB: d6dpua2, d6dpub2, d6dpuc2, d6dpud2, d6dpue2, d6dpuf2, d6dpug2, d6dpuh2, d6dpui2, d6dpuj2, d6dpuk2, d6dpul2
    automated match to d4drxb1
    complexed with g2p, gtp, mg

Details for d6dpuf1

PDB Entry: 6dpu (more details), 3.1 Å

PDB Description: undecorated gmpcpp microtubule
PDB Compounds: (F:) Tubulin beta chain

SCOPe Domain Sequences for d6dpuf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dpuf1 c.32.1.1 (F:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvv
epynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d6dpuf1:

Click to download the PDB-style file with coordinates for d6dpuf1.
(The format of our PDB-style files is described here.)

Timeline for d6dpuf1:

  • d6dpuf1 appears in periodic updates to SCOPe 2.07 starting on 2018-07-05