SCOPe 2.08: Domain d6a0xb2: 6a0x B:108-214

Lineage for d6a0xb2 (6a0x B:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d6a0xb2: 6a0x B:108-214 [354221]
   Other proteins in same PDB: d6a0xa_, d6a0xb1, d6a0xc_, d6a0xd1, d6a0xe_, d6a0xf1, d6a0xg_, d6a0xh1
   automated match to d1tqbc2

Details for d6a0xb2

PDB Entry: 6a0x, 2.3 Å

PDB Description: crystal structure of broadly neutralizing antibody 13d4

PDB Compounds: (B:) Antibody 13D4, Fab Light Chain

SCOPe Domain Sequences for d6a0xb2:

Sequence; same for both SEQRES and ATOM records:

>d6a0xb2 b.1.1.2 (B:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltrdeyerhnsytceathktstspivksfnrnec

Timeline for d6a0xb2:

• d6a0xb2 first appeared in SCOPe 2.07