Lineage for d6daua_ (6dau A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2576103Species Vibrio cholerae [TaxId:666] [188612] (22 PDB entries)
  8. 2576153Domain d6daua_: 6dau A: [354218]
    automated match to d4mhdc_
    complexed with gol; mutant

Details for d6daua_

PDB Entry: 6dau (more details), 2.26 Å

PDB Description: crystal structure of e33q and e41q mutant forms of the spermidine/spermine n-acetyltransferase speg from vibrio cholerae
PDB Compounds: (A:) Spermidine n1-acetyltransferase

SCOPe Domain Sequences for d6daua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6daua_ d.108.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]}
nsqltlralergdlrfihnlnnnrnimsywfqepyesfdqleelynkhihdnaerrfvve
daqknliglvelieinyihrsaefqiiiapehqgkgfartlinraldysftilnlhkiyl
hvavenpkavhlyeecgfveeghlveeffingryqdvkrmyilqskylnr

SCOPe Domain Coordinates for d6daua_:

Click to download the PDB-style file with coordinates for d6daua_.
(The format of our PDB-style files is described here.)

Timeline for d6daua_: