![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
![]() | Protein automated matches [190976] (4 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188649] (64 PDB entries) |
![]() | Domain d6bynm_: 6byn M: [354213] Other proteins in same PDB: d6bynw1, d6bynw2 automated match to d3uyod_ |
PDB Entry: 6byn (more details), 2.69 Å
SCOPe Domain Sequences for d6bynm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6bynm_ b.1.2.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vssvptklevvaatptslliswdapavtvvhyvitygetggnspvqkfkvpgskstatis glkpgvdytitvyayqgggrwhpygyyspisinyrt
Timeline for d6bynm_: