Lineage for d6bynm_ (6byn M:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2359497Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 2359498Protein automated matches [190976] (4 species)
    not a true protein
  7. 2359522Species Human (Homo sapiens) [TaxId:9606] [188649] (64 PDB entries)
  8. 3054151Domain d6bynm_: 6byn M: [354213]
    Other proteins in same PDB: d6bynw1, d6bynw2
    automated match to d3uyod_

Details for d6bynm_

PDB Entry: 6byn (more details), 2.69 Å

PDB Description: crystal structure of wdr5-mb(s4) monobody complex
PDB Compounds: (M:) WDR5-binding Monobody, Mb(S4)

SCOPe Domain Sequences for d6bynm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bynm_ b.1.2.0 (M:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vssvptklevvaatptslliswdapavtvvhyvitygetggnspvqkfkvpgskstatis
glkpgvdytitvyayqgggrwhpygyyspisinyrt

SCOPe Domain Coordinates for d6bynm_:

Click to download the PDB-style file with coordinates for d6bynm_.
(The format of our PDB-style files is described here.)

Timeline for d6bynm_:

  • d6bynm_ is new in SCOPe 2.07-stable