Lineage for d6b9ba1 (6b9b A:36-440)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328246Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2328247Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2328973Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2328974Protein automated matches [191104] (14 species)
    not a true protein
  7. 3050023Species Burkholderia pseudomallei [TaxId:320372] [350085] (5 PDB entries)
  8. 3054143Domain d6b9ba1: 6b9b A:36-440 [354205]
    automated match to d2ccda1
    complexed with cl, hem, mal, mpd, na, oxy, po4

Details for d6b9ba1

PDB Entry: 6b9b (more details), 1.8 Å

PDB Description: crystal structure of the catalase-peroxidase from b. pseudomallei with maltose bound
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d6b9ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b9ba1 a.93.1.0 (A:36-440) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwpi
kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
payekisrrfhenpeqfadafarawfklthrdmgprarylgpevp

SCOPe Domain Coordinates for d6b9ba1:

Click to download the PDB-style file with coordinates for d6b9ba1.
(The format of our PDB-style files is described here.)

Timeline for d6b9ba1:

  • d6b9ba1 is new in SCOPe 2.07-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d6b9ba2