Lineage for d6bwba_ (6bwb A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. Protein automated matches [190220] (14 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [189070] (63 PDB entries)
  8. Domain d6bwba_: 6bwb A: [354196]
    automated match to d4uaea_

Details for d6bwba_

PDB Entry: 6bwb (more details), 2.3 Å

PDB Description: hendra virus w protein c-terminus in complex with importin alpha 3 crystal form 3
PDB Compounds: (A:) Importin subunit alpha-3

SCOPe Domain Sequences for d6bwba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6bwba_ a.118.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sleaivqnassdnqgiqlsavqaarkllssdrnppiddliksgilpilvhclerddnpsl
qfeaawaltniasgtseqtqavvqsnavplflrllhsphqnvceqavwalgniigdgpqc
rdyvislgvvkpllsfispsipitflrnvtwvmvnlcrhkdppppmetiqeilpalcvli
hhtdvnilvdtvwalsyltdagneqiqmvidsgivphlvpllshqevkvqtaalravgni
vtgtdeqtqvvlncdalshfpallthpkekinkeavwflsnitagnqqqvqavidanlvp
miihlldkgdfgtqkeaawaisnltisgrkdqvayliqqnvippfcnlltvkdaqvvqvv
ldglsnilkmaedeaetignlieecgglekieqlqnhenediyklayeiidqffss

SCOPe Domain Coordinates for d6bwba_ are not available.

Timeline for d6bwba_: