![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest |
![]() | Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) ![]() |
![]() | Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins) |
![]() | Protein Phosphoglucomutase [53740] (1 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries) |
![]() | Domain d1vklb3: 1vkl B:304-420 [35419] Other proteins in same PDB: d1vkla4, d1vklb4 complexed with ni |
PDB Entry: 1vkl (more details), 2.7 Å
SCOPe Domain Sequences for d1vklb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vklb3 c.84.1.1 (B:304-420) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkffgn lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
Timeline for d1vklb3:
![]() Domains from other chains: (mouse over for more information) d1vkla1, d1vkla2, d1vkla3, d1vkla4 |