Lineage for d5oyag1 (5oya G:15-153)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2559642Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2559863Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2559864Protein automated matches [226983] (27 species)
    not a true protein
  7. 2559883Species Chaetoceros socialis [TaxId:163503] [353962] (1 PDB entry)
  8. 2559890Domain d5oyag1: 5oya G:15-153 [354184]
    Other proteins in same PDB: d5oyaa2, d5oyab2, d5oyac2, d5oyad2, d5oyae2, d5oyaf2, d5oyag2, d5oyah2, d5oyai_, d5oyaj_, d5oyak_, d5oyal_, d5oyam_, d5oyan_, d5oyao_, d5oyap_
    automated match to d1bwva2
    complexed with cap, edo, mg

Details for d5oyag1

PDB Entry: 5oya (more details), 1.8 Å

PDB Description: unusual posttranslational modifications revealed in crystal structures of diatom rubisco.
PDB Compounds: (G:) Rubisco large subunit

SCOPe Domain Sequences for d5oyag1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oyag1 d.58.9.0 (G:15-153) automated matches {Chaetoceros socialis [TaxId: 163503]}
ryesgvipyakmgywdaaytvkdtdvlalfritpqpgvdpveaaaavagesstatwtvvw
tdlltaceryrakayrvdpvpnstdvyfafiayecdlfeeaslanltasiignvfgfkai
salrledmriphsylxtfq

SCOPe Domain Coordinates for d5oyag1:

Click to download the PDB-style file with coordinates for d5oyag1.
(The format of our PDB-style files is described here.)

Timeline for d5oyag1: