Lineage for d1vklb2 (1vkl B:191-303)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 592570Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 592571Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) (S)
  5. 592572Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 592587Protein Phosphoglucomutase [53740] (1 species)
  7. 592588Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries)
  8. 592599Domain d1vklb2: 1vkl B:191-303 [35418]
    Other proteins in same PDB: d1vkla4, d1vklb4

Details for d1vklb2

PDB Entry: 1vkl (more details), 2.7 Å

PDB Description: rabbit muscle phosphoglucomutase

SCOP Domain Sequences for d1vklb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vklb2 c.84.1.1 (B:191-303) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus)}
veayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceelgapansavnc
vpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhgffv

SCOP Domain Coordinates for d1vklb2:

Click to download the PDB-style file with coordinates for d1vklb2.
(The format of our PDB-style files is described here.)

Timeline for d1vklb2: