Lineage for d5w62a_ (5w62 A:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2626588Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2626682Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2626683Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 2626864Protein Proapoptotic molecule Bax [56862] (3 species)
  7. 2626876Species Mus musculus [TaxId:10090] [354174] (1 PDB entry)
  8. 2626877Domain d5w62a_: 5w62 A: [354175]
    automated match to d2k7wa_
    complexed with so4

Details for d5w62a_

PDB Entry: 5w62 (more details), 2.2 Å

PDB Description: crystal structure of mouse bax monomer
PDB Compounds: (A:) Apoptosis regulator BAX

SCOPe Domain Sequences for d5w62a_:

Sequence, based on SEQRES records: (download)

>d5w62a_ f.1.4.1 (A:) Proapoptotic molecule Bax {Mus musculus [TaxId: 10090]}
ptsseqimktgafllqgfiqdragrmagetpeltleqppqdastkklseslrrigdelds
nmelqrmiadvdtdsprevffrvaadmfadgnfnwgrvvalfyfasklvlkalstkvpel
irtimgwtldflrerllvwiqdqggwegllsyfgtptwqtvtifvagvltasltiwk

Sequence, based on observed residues (ATOM records): (download)

>d5w62a_ f.1.4.1 (A:) Proapoptotic molecule Bax {Mus musculus [TaxId: 10090]}
ptsseqimktgafllqgfiqdradastkklseslrrigdeldsnmelqrmiadvdtdspr
evffrvaadmfadgnfnwgrvvalfyfasklvlkalpelirtimgwtldflrerllvwiq
dqggwegllsyfgtptwqtvtifvagvltasltiwk

SCOPe Domain Coordinates for d5w62a_:

Click to download the PDB-style file with coordinates for d5w62a_.
(The format of our PDB-style files is described here.)

Timeline for d5w62a_: