Lineage for d6brfb1 (6brf B:2-243)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2445156Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2445157Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2445158Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 2445283Protein automated matches [226837] (7 species)
    not a true protein
  7. 2445466Species Pig (Sus scrofa) [TaxId:9823] [278808] (24 PDB entries)
  8. 3054099Domain d6brfb1: 6brf B:2-243 [354161]
    Other proteins in same PDB: d6brfa2, d6brfb2, d6brfc2, d6brfd2, d6brfe_, d6brff1, d6brff2, d6brff3
    automated match to d4drxb1
    complexed with acp, ca, e44, gdp, gtp, mes, mg

Details for d6brfb1

PDB Entry: 6brf (more details), 2.5 Å

PDB Description: tubulin-rb3_sld-ttl in complex with heterocyclic pyrimidine compound 4b
PDB Compounds: (B:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6brfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6brfb1 c.32.1.1 (B:2-243) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fp

SCOPe Domain Coordinates for d6brfb1:

Click to download the PDB-style file with coordinates for d6brfb1.
(The format of our PDB-style files is described here.)

Timeline for d6brfb1:

  • d6brfb1 appears in periodic updates to SCOPe 2.07 starting on 2018-06-28