SCOPe 2.07: Domain d5xuwa_: 5xuw A:

Lineage for d5xuwa_ (5xuw A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.2: Lysozyme-like [53954] (1 superfamily)
   common alpha+beta motif for the active site region

4. Superfamily d.2.1: Lysozyme-like [53955] (12 families)

5. Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
   automatically mapped to Pfam PF00062

6. Protein automated matches [190299] (8 species)
   not a true protein

7. Species Equus asinus [TaxId:9793] [354124] (1 PDB entry)

8. Domain d5xuwa_: 5xuw A: [354157]
   automated match to d2eqla_
   complexed with ca

Details for d5xuwa_

PDB Entry: 5xuw, 1.76 Å

PDB Description: crystal structure of lysozyme from equus asinus

PDB Compounds: (A:) Lysozyme C

SCOPe Domain Sequences for d5xuwa_:

Sequence; same for both SEQRES and ATOM records:

>d5xuwa_ d.2.1.2 (A:) automated matches {Equus asinus [TaxId: 9793]}
kvfskcelahklkaqemdgfggyslanwvcmaeyesnfntrafngknangsydyglfqln
skwwckdnkrsssnacnimcskllddnidddiscakrvvrdpkgmsawkawvkhckdkdl
seylascnl

Timeline for d5xuwa_:

• d5xuwa_ is new in SCOPe 2.07-stable
  
• d5xuwa_ appears in the current release, SCOPe 2.08