Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) contains a single copy of this fold and an extra beta-strand at the C-terminus |
Family d.129.2.0: automated matches [254315] (1 protein) not a true family |
Protein automated matches [254722] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [316258] (15 PDB entries) |
Domain d5veca4: 5vec A:422-562 [354138] Other proteins in same PDB: d5veca1, d5veca2, d5veca3, d5veca5, d5vecb1, d5vecb2, d5vecb3, d5vecb5 automated match to d5jn5a4 complexed with gol, mg, so4 |
PDB Entry: 5vec (more details), 2.2 Å
SCOPe Domain Sequences for d5veca4:
Sequence; same for both SEQRES and ATOM records: (download)
>d5veca4 d.129.2.0 (A:422-562) automated matches {Human (Homo sapiens) [TaxId: 9606]} rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd gsisrnqglrliftdgsrivfrlsgtgsagatillyidsyekdvakinqdpqvmlaplis ialkvsqlqertgrtaptvit
Timeline for d5veca4: