Lineage for d5veca4 (5vec A:422-562)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families) (S)
    contains a single copy of this fold and an extra beta-strand at the C-terminus
  5. Family d.129.2.0: automated matches [254315] (1 protein)
    not a true family
  6. Protein automated matches [254722] (4 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [316258] (14 PDB entries)
  8. Domain d5veca4: 5vec A:422-562 [354138]
    Other proteins in same PDB: d5veca1, d5veca2, d5veca3, d5veca5, d5vecb1, d5vecb2, d5vecb3, d5vecb5
    automated match to d5jn5a4
    complexed with gol, mg, so4

Details for d5veca4

PDB Entry: 5vec (more details), 2.2 Å

PDB Description: crystal structure of the r515l missense variant of human pgm1
PDB Compounds: (A:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5veca4:

Sequence; same for both SEQRES and ATOM records: (download)

>d5veca4 d.129.2.0 (A:422-562) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsgtgsagatillyidsyekdvakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

SCOPe Domain Coordinates for d5veca4 are not available.

Timeline for d5veca4:

Domains from same chain:
(mouse over for more information)
d5veca1, d5veca2, d5veca3, d5veca5
Domains from other chains:
(mouse over for more information)
d5vecb1, d5vecb2, d5vecb3, d5vecb4, d5vecb5