Lineage for d5xuqa_ (5xuq A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2335122Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2335123Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2335124Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2336099Protein Vitamin D nuclear receptor [48528] (2 species)
  7. 2336128Species Norway rat (Rattus norvegicus) [TaxId:10116] [101432] (25 PDB entries)
  8. 3054070Domain d5xuqa_: 5xuq A: [354132]
    automated match to d1ie9a_
    complexed with 8ff

Details for d5xuqa_

PDB Entry: 5xuq (more details), 2.8 Å

PDB Description: crystal structure of vdr-lbd complexed with an antagonist, 2- methylidene-19,26,27-trinor-22-(s)-butyl-1-hydroxy-25-oxo-25-(1h- pyrrol-2-yl)- vitamin d3
PDB Compounds: (A:) Vitamin D3 receptor

SCOPe Domain Sequences for d5xuqa_:

Sequence, based on SEQRES records: (download)

>d5xuqa_ a.123.1.1 (A:) Vitamin D nuclear receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klseeqqhiiailldahhktydptyadfrdfrppvrmdgstgsvtldlsplsmlphladl
vsysiqkvigfakmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdy
kydvtdvskaghtlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklve
aiqdrlsntlqtyircrhpppgshqlyakmiqkladlrslneehskqyrslsfqpensmk
ltplvlevfg

Sequence, based on observed residues (ATOM records): (download)

>d5xuqa_ a.123.1.1 (A:) Vitamin D nuclear receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klseeqqhiiailldahhktydptyadfrdfrppvrsplsmlphladlvsysiqkvigfa
kmipgfrdltsddqivllkssaievimlrsnqsftmddmswdcgsqdykydvtdvskagh
tlelieplikfqvglkklnlheeehvllmaicivspdrpgvqdaklveaiqdrlsntlqt
yircrhpppgshqlyakmiqkladlrslneehskqpensmkltplvlevfg

SCOPe Domain Coordinates for d5xuqa_:

Click to download the PDB-style file with coordinates for d5xuqa_.
(The format of our PDB-style files is described here.)

Timeline for d5xuqa_:

  • d5xuqa_ appears in periodic updates to SCOPe 2.07 starting on 2018-06-28