Lineage for d3pmgb3 (3pmg B:304-420)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2159229Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2159230Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2159231Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (3 proteins)
  6. 2159246Protein Phosphoglucomutase [53740] (1 species)
  7. 2159247Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries)
  8. 2159253Domain d3pmgb3: 3pmg B:304-420 [35413]
    Other proteins in same PDB: d3pmga4, d3pmgb4
    complexed with mg

Details for d3pmgb3

PDB Entry: 3pmg (more details), 2.4 Å

PDB Description: structure of rabbit muscle phosphoglucomutase at 2.4 angstroms resolution. use of freezing point depressant and reduced temperature to enhance diffractivity
PDB Compounds: (B:) alpha-d-glucose-1,6-bisphosphate

SCOPe Domain Sequences for d3pmgb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pmgb3 c.84.1.1 (B:304-420) Phosphoglucomutase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkffgn
lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg

SCOPe Domain Coordinates for d3pmgb3:

Click to download the PDB-style file with coordinates for d3pmgb3.
(The format of our PDB-style files is described here.)

Timeline for d3pmgb3: