![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
![]() | Protein Proapoptotic molecule Bax [56862] (3 species) |
![]() | Species Ictalurus punctatus [TaxId:7998] [354102] (1 PDB entry) |
![]() | Domain d5w63a_: 5w63 A: [354103] automated match to d4s0oa_ complexed with edo, so4 |
PDB Entry: 5w63 (more details), 2.44 Å
SCOPe Domain Sequences for d5w63a_:
Sequence, based on SEQRES records: (download)
>d5w63a_ f.1.4.1 (A:) Proapoptotic molecule Bax {Ictalurus punctatus [TaxId: 7998]} tsndqilevgavllkdfiyervhrhgdsgtvvsrhelggselsdpthkklaqylqqigde ldnnvdlqrmladsalqptkevfvkvareifsdgkfnwgrvvalfyfasrlviealltki pdiirtiinwtldylrehvinwireqggwegiqtyfgtptwktvgvflagvlttvlvm
>d5w63a_ f.1.4.1 (A:) Proapoptotic molecule Bax {Ictalurus punctatus [TaxId: 7998]} tsndqilevgavllkdfiyervhrhtvvsrhelggselsdpthkklaqylqqigdeldnn vdlqrmladsalqptkevfvkvareifsdgkfnwgrvvalfyfasrlviealltkipdii rtiinwtldylrehvinwireqggwegiqtyfgtptwktvgvflagvlttvlvm
Timeline for d5w63a_: