Lineage for d5w63a_ (5w63 A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021035Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 3021129Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 3021130Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
    Pfam PF00452
  6. 3021466Protein Proapoptotic molecule Bax [56862] (3 species)
  7. 3021476Species Ictalurus punctatus [TaxId:7998] [354102] (1 PDB entry)
  8. 3021477Domain d5w63a_: 5w63 A: [354103]
    automated match to d4s0oa_
    complexed with edo, so4

Details for d5w63a_

PDB Entry: 5w63 (more details), 2.44 Å

PDB Description: crystal structure of channel catfish bax
PDB Compounds: (A:) Apoptosis regulator BAX

SCOPe Domain Sequences for d5w63a_:

Sequence, based on SEQRES records: (download)

>d5w63a_ f.1.4.1 (A:) Proapoptotic molecule Bax {Ictalurus punctatus [TaxId: 7998]}
tsndqilevgavllkdfiyervhrhgdsgtvvsrhelggselsdpthkklaqylqqigde
ldnnvdlqrmladsalqptkevfvkvareifsdgkfnwgrvvalfyfasrlviealltki
pdiirtiinwtldylrehvinwireqggwegiqtyfgtptwktvgvflagvlttvlvm

Sequence, based on observed residues (ATOM records): (download)

>d5w63a_ f.1.4.1 (A:) Proapoptotic molecule Bax {Ictalurus punctatus [TaxId: 7998]}
tsndqilevgavllkdfiyervhrhtvvsrhelggselsdpthkklaqylqqigdeldnn
vdlqrmladsalqptkevfvkvareifsdgkfnwgrvvalfyfasrlviealltkipdii
rtiinwtldylrehvinwireqggwegiqtyfgtptwktvgvflagvlttvlvm

SCOPe Domain Coordinates for d5w63a_:

Click to download the PDB-style file with coordinates for d5w63a_.
(The format of our PDB-style files is described here.)

Timeline for d5w63a_: