Lineage for d3pmga3 (3pmg A:304-420)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27709Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
  4. 27710Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (1 family) (S)
  5. 27711Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (1 protein)
  6. 27712Protein Phosphoglucomutase, first 3 domains [53740] (1 species)
  7. 27713Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53741] (6 PDB entries)
  8. 27716Domain d3pmga3: 3pmg A:304-420 [35410]
    Other proteins in same PDB: d3pmga4, d3pmgb4

Details for d3pmga3

PDB Entry: 3pmg (more details), 2.4 Å

PDB Description: structure of rabbit muscle phosphoglucomutase at 2.4 angstroms resolution. use of freezing point depressant and reduced temperature to enhance diffractivity

SCOP Domain Sequences for d3pmga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pmga3 c.84.1.1 (A:304-420) Phosphoglucomutase, first 3 domains {Rabbit (Oryctolagus cuniculus)}
npsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkffgn
lmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg

SCOP Domain Coordinates for d3pmga3:

Click to download the PDB-style file with coordinates for d3pmga3.
(The format of our PDB-style files is described here.)

Timeline for d3pmga3: