Lineage for d6br1d2 (6br1 D:244-431)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2525085Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2525406Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2525407Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 2525526Protein automated matches [227071] (5 species)
    not a true protein
  7. 2525709Species Pig (Sus scrofa) [TaxId:9823] [278816] (24 PDB entries)
  8. 3054020Domain d6br1d2: 6br1 D:244-431 [354082]
    Other proteins in same PDB: d6br1a1, d6br1b1, d6br1c1, d6br1d1, d6br1e_, d6br1f1, d6br1f2, d6br1f3
    automated match to d3rycd2
    complexed with acp, ca, e3y, gdp, gtp, mes, mg

Details for d6br1d2

PDB Entry: 6br1 (more details), 2.3 Å

PDB Description: tubulin-rb3_sld-ttl in complex with heterocyclic pyrimidine compound 4a
PDB Compounds: (D:) Tubulin beta-2B chain

SCOPe Domain Sequences for d6br1d2:

Sequence, based on SEQRES records: (download)

>d6br1d2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdsknmmaac
dprhgryltvaaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkm
satfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyq
qyqdatad

Sequence, based on observed residues (ATOM records): (download)

>d6br1d2 d.79.2.1 (D:244-431) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
gqlnadlrklavnmvpfprlhffmpgfaplltvpeltqqmfdsknmmaacdprhgryltv
aaifrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprglkmsatfignsta
iqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvseyqqyqdatad

SCOPe Domain Coordinates for d6br1d2:

Click to download the PDB-style file with coordinates for d6br1d2.
(The format of our PDB-style files is described here.)

Timeline for d6br1d2:

  • d6br1d2 appears in periodic updates to SCOPe 2.07 starting on 2018-06-28