SCOPe 2.08: Domain d5w5zl1: 5w5z L:1-106

Lineage for d5w5zl1 (5w5z L:1-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [225064] (19 PDB entries)

8. Domain d5w5zl1: 5w5z L:1-106 [354067]
   Other proteins in same PDB: d5w5zh_
   automated match to d3b9kc1
   complexed with edo, mes, pg4, pge

Details for d5w5zl1

PDB Entry: 5w5z, 2 Å

PDB Description: crystal structure of baxp168g in complex with an activating antibody at high resolution

PDB Compounds: (L:) 3C10 Fab light chain

SCOPe Domain Sequences for d5w5zl1:

Sequence; same for both SEQRES and ATOM records:

>d5w5zl1 b.1.1.0 (L:1-106) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
diqmtqspsflsasvgdrvtinckasqnvnkyldwyqqnlgeppklliyhtnslptgips
rfsgsgsgtdftltisslqvedvatyfclqhdsgltfgsgtkleik

Timeline for d5w5zl1:

• d5w5zl1 first appeared in SCOPe 2.07