Lineage for d5zcjc1 (5zcj C:1486-1537)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784517Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 2784518Family b.34.9.1: Tudor domain [63749] (9 proteins)
    Pfam PF00567
  6. 2784606Protein p53-binding protein 1, 53BP1, N-terminal domain [418914] (1 species)
    protein duplication: contains two Tudor domains in tandem
  7. 2784607Species Human (Homo sapiens) [TaxId:9606] [419338] (18 PDB entries)
    Uniprot Q12888 1485-1602 ! Uniprot Q12888 1484-1606
  8. 2784620Domain d5zcjc1: 5zcj C:1486-1537 [354061]
    Other proteins in same PDB: d5zcja_, d5zcjb_, d5zcjc2
    automated match to d2lvma1

Details for d5zcjc1

PDB Entry: 5zcj (more details), 2 Å

PDB Description: crystal structure of complex
PDB Compounds: (C:) TP53-binding protein 1

SCOPe Domain Sequences for d5zcjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5zcjc1 b.34.9.1 (C:1486-1537) p53-binding protein 1, 53BP1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
fvglrvvakwssngyfysgkitrdvgagkykllfddgyecdvlgkdillcdp

SCOPe Domain Coordinates for d5zcjc1:

Click to download the PDB-style file with coordinates for d5zcjc1.
(The format of our PDB-style files is described here.)

Timeline for d5zcjc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5zcjc2