Lineage for d5wjca_ (5wjc A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418399Superfamily b.69.4: WD40 repeat-like [50978] (4 families) (S)
    also contains 8-bladed propellers
  5. 2418634Family b.69.4.0: automated matches [191412] (1 protein)
    not a true family
  6. 2418635Protein automated matches [190568] (9 species)
    not a true protein
  7. 2418835Species Schizosaccharomyces pombe [TaxId:284812] [354059] (1 PDB entry)
  8. 2418836Domain d5wjca_: 5wjc A: [354060]
    automated match to d4xyha_

Details for d5wjca_

PDB Entry: 5wjc (more details), 2.3 Å

PDB Description: crystal structure of schizosaccharomyces pombe mis16 in complex with eic1
PDB Compounds: (A:) Kinetochore protein Mis16

SCOPe Domain Sequences for d5wjca_:

Sequence, based on SEQRES records: (download)

>d5wjca_ b.69.4.0 (A:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
elnaeidlqktiqeeyklwkqnvpflydlvithalewpsltiqwlpdkktipgtdysiqr
lilgthtsgndqnylqiasvqlpnfdedtteftpstirraqatgsytieisqkiphdgdv
nrarympqkpeiiatmgeggnayifdttchdalttgealpqavlkghtaegfglcwnpnl
pgnlatgaedqviclwdvqtqsftssetkvispiakyhrhtdivndvqfhpqheallasv
sddctlqihdtrlnpeeeapkviqahskainavainpfndyllatasadktvalwdlrnp
yqrlhtleghedevyglewsphdepilassstdrrvciwdlekigeeqtpedaedgspel
lfmhgghtnrisefswcpnerwvvgsladdnilqiwspsrviwg

Sequence, based on observed residues (ATOM records): (download)

>d5wjca_ b.69.4.0 (A:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
elnaeidlqktiqeeyklwkqnvpflydlvithalewpsltiqwlpdkktipgtdysiqr
lilgthtsgndqnylqiasvqlpnsytieisqkiphdgdvnrarympqkpeiiatmgegg
nayifdttchdalttgealpqavlkghtaegfglcwnpnlpgnlatgaedqviclwdvqt
qsftssetkvispiakyhrhtdivndvqfhpqheallasvsddctlqihdtrlnpeeeap
kviqahskainavainpfndyllatasadktvalwdlrnpyqrlhtleghedevyglews
phdepilassstdrrvciwdlekigeeqtpedaedgspellfmhgghtnrisefswcpne
rwvvgsladdnilqiwspsrviwg

SCOPe Domain Coordinates for d5wjca_:

Click to download the PDB-style file with coordinates for d5wjca_.
(The format of our PDB-style files is described here.)

Timeline for d5wjca_: