Lineage for d1nis_2 (1nis 2-528)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74791Fold c.83: Aconitase, first 3 domains [53731] (1 superfamily)
  4. 74792Superfamily c.83.1: Aconitase, first 3 domains [53732] (1 family) (S)
  5. 74793Family c.83.1.1: Aconitase, first 3 domains [53733] (1 protein)
  6. 74794Protein Aconitase, first 3 domains [53734] (2 species)
  7. 74795Species Cow (Bos taurus) [TaxId:9913] [53736] (9 PDB entries)
  8. 74802Domain d1nis_2: 1nis 2-528 [35406]
    Other proteins in same PDB: d1nis_1

Details for d1nis_2

PDB Entry: 1nis (more details), 2.05 Å

PDB Description: crystal structure of aconitase with trans-aconitate and nitrocitrate bound

SCOP Domain Sequences for d1nis_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nis_2 c.83.1.1 (2-528) Aconitase, first 3 domains {Cow (Bos taurus)}
rakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkty
lrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdinq
evynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicigv
ggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaiveyh
gpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlvp
dsgchydqlieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctns
syedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlanac
gpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkfn
petdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqr

SCOP Domain Coordinates for d1nis_2:

Click to download the PDB-style file with coordinates for d1nis_2.
(The format of our PDB-style files is described here.)

Timeline for d1nis_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nis_1