Lineage for d5z5ba1 (5z5b A:1-147)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2454571Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 2454572Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (6 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 2455001Family c.45.1.0: automated matches [191381] (1 protein)
    not a true family
  6. 2455002Protein automated matches [190475] (10 species)
    not a true protein
  7. 3053990Species Thermococcus kodakarensis [TaxId:69014] [354052] (1 PDB entry)
  8. 3053991Domain d5z5ba1: 5z5b A:1-147 [354053]
    Other proteins in same PDB: d5z5ba2, d5z5bb2, d5z5bc2
    automated match to d5bx1a_
    complexed with cl, fmt; mutant

Details for d5z5ba1

PDB Entry: 5z5b (more details), 2.3 Å

PDB Description: crystal structure of tk-ptp in the g95a mutant form
PDB Compounds: (A:) protein-tyrosine phosphatase

SCOPe Domain Sequences for d5z5ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z5ba1 c.45.1.0 (A:1-147) automated matches {Thermococcus kodakarensis [TaxId: 69014]}
mwpsakfidgrvafsrmpaereldevardfdavvvlvedyelpysldewekrgvevlhgp
ipdftapsveqlleilrwieervregkkvlihcmaglgrsgtvgvawlmysrglslreal
mevrrkrpgavetqeqmevlkeleeri

SCOPe Domain Coordinates for d5z5ba1:

Click to download the PDB-style file with coordinates for d5z5ba1.
(The format of our PDB-style files is described here.)

Timeline for d5z5ba1:

  • d5z5ba1 is new in SCOPe 2.07-stable