Lineage for d5xvbs_ (5xvb S:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3019032Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
    2 domains: (1) alpa/beta; (2) Fe-S cluster-bound
  4. 3019033Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) (S)
  5. 3019205Family e.19.1.0: automated matches [191636] (1 protein)
    not a true family
  6. 3019206Protein automated matches [191172] (11 species)
    not a true protein
  7. 3019212Species Citrobacter sp. [TaxId:1080067] [354039] (2 PDB entries)
  8. 3019213Domain d5xvbs_: 5xvb S: [354040]
    Other proteins in same PDB: d5xvbl_, d5xvbm_
    automated match to d3myra_
    complexed with f3s, gol, mg, nfu, sf4

Details for d5xvbs_

PDB Entry: 5xvb (more details), 1.84 Å

PDB Description: [nife]-hydrogenase (hyb-type) from citrobacter sp. s-77 in an h2- reduced condition
PDB Compounds: (S:) [NiFe]-hydrogenase 2 small subunit

SCOPe Domain Sequences for d5xvbs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xvbs_ e.19.1.0 (S:) automated matches {Citrobacter sp. [TaxId: 1080067]}
pqrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghqveenkhna
lekykgqyvlvvdgsiplkdngiycmvagepivdhirraaegaaaiiaigscaawggvaa
agvnptgavglqevlpgktiinipgcppnphnflatvahiitygkppkldaknrptfayg
rlihehcerrphfdagrfakefgdeghregwclyhlgckgpetygncstlqfcdvggvwp
vaighpcygcneegigfhkgihqlahve

SCOPe Domain Coordinates for d5xvbs_:

Click to download the PDB-style file with coordinates for d5xvbs_.
(The format of our PDB-style files is described here.)

Timeline for d5xvbs_: