Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.19: HydA/Nqo6-like [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families) |
Family e.19.1.0: automated matches [191636] (1 protein) not a true family |
Protein automated matches [191172] (11 species) not a true protein |
Species Citrobacter sp. [TaxId:1080067] [354039] (2 PDB entries) |
Domain d5xvbs_: 5xvb S: [354040] Other proteins in same PDB: d5xvbl_, d5xvbm_ automated match to d3myra_ complexed with f3s, gol, mg, nfu, sf4 |
PDB Entry: 5xvb (more details), 1.84 Å
SCOPe Domain Sequences for d5xvbs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xvbs_ e.19.1.0 (S:) automated matches {Citrobacter sp. [TaxId: 1080067]} pqrppviwigaqectgctesllrathptvenlvletisleyhevlsaafghqveenkhna lekykgqyvlvvdgsiplkdngiycmvagepivdhirraaegaaaiiaigscaawggvaa agvnptgavglqevlpgktiinipgcppnphnflatvahiitygkppkldaknrptfayg rlihehcerrphfdagrfakefgdeghregwclyhlgckgpetygncstlqfcdvggvwp vaighpcygcneegigfhkgihqlahve
Timeline for d5xvbs_: