SCOPe 2.07: Domain d6ftlc1: 6ftl C:3-153

Lineage for d6ftlc1 (6ftl C:3-153)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Skeletonema marinoi [TaxId:267567] [353914] (1 PDB entry)

8. Domain d6ftlc1: 6ftl C:3-153 [354019]
   Other proteins in same PDB: d6ftla2, d6ftlc2, d6ftle2, d6ftlg2, d6ftli_, d6ftlj_, d6ftlk_, d6ftll_
   automated match to d1bwva2
   complexed with cap, edo, mg

Details for d6ftlc1

PDB Entry: 6ftl, 2.6 Å

PDB Description: rubisco from skeletonema marinoi

PDB Compounds: (C:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6ftlc1:

Sequence; same for both SEQRES and ATOM records:

>d6ftlc1 d.58.9.0 (C:3-153) automated matches {Skeletonema marinoi [TaxId: 267567]}
qsvsertriksdryesgvipyakmgywdasytvkdtdvlalfritpqpgvdpveaaaava
gesstatwtvvwtdlltaceryrakayrvdpvpnsadvffafiayecdlfeeaslanlta
siignvfgfkavsalrledmriphsylxtfq

Timeline for d6ftlc1:

• d6ftlc1 is new in SCOPe 2.07-stable
  
• d6ftlc1 appears in the current release, SCOPe 2.08