SCOPe 2.08: Domain d5vinb4: 5vin B:422-562

Lineage for d5vinb4 (5vin B:422-562)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.2: Phosphoglucomutase, C-terminal domain [55957] (2 families)
   contains a single copy of this fold and an extra beta-strand at the C-terminus

5. Family d.129.2.0: automated matches [254315] (1 protein)
   not a true family

6. Protein automated matches [254722] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [316258] (14 PDB entries)

8. Domain d5vinb4: 5vin B:422-562 [354017]
   Other proteins in same PDB: d5vina1, d5vina2, d5vina3, d5vina5, d5vinb1, d5vinb2, d5vinb3
   automated match to d5jn5a4
   complexed with co, gol, so4

Details for d5vinb4

PDB Entry: 5vin, 2.6 Å

PDB Description: crystal structure of the r515q missense variant of human pgm1

PDB Compounds: (B:) Phosphoglucomutase-1

SCOPe Domain Sequences for d5vinb4:

Sequence, based on SEQRES records:

>d5vinb4 d.129.2.0 (B:422-562) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsandkvytvekadnfeysdpvd
gsisrnqglrliftdgsrivfrlsgtgsagatiqlyidsyekdvakinqdpqvmlaplis
ialkvsqlqertgrtaptvit

Sequence, based on observed residues (ATOM records):

>d5vinb4 d.129.2.0 (B:422-562) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rnfftrydyeeveaegankmmkdlealmfdrsfvgkqfsanvytvekadnfeysdpvdgs
isrnqglrliftdgsrivfrlsgtgsagatiqlyidsyekdvakinqdpqvmlaplisia
lkvsqlqertgrtaptvit

Timeline for d5vinb4:

• d5vinb4 first appeared in SCOPe 2.07