Lineage for d6exsa_ (6exs A:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028261Fold f.38: MFS general substrate transporter [103472] (1 superfamily)
    12 transmembrane helices; duplication: the N- and C-terminal halves are structurally similar
  4. 3028262Superfamily f.38.1: MFS general substrate transporter [103473] (5 families) (S)
  5. 3028307Family f.38.1.0: automated matches [354001] (1 protein)
    not a true family
  6. 3028308Protein automated matches [354002] (3 species)
    not a true protein
  7. 3028314Species Staphylococcus hominis [TaxId:1290] [354003] (4 PDB entries)
  8. 3028316Domain d6exsa_: 6exs A: [354004]
    automated match to d4ikva_
    complexed with c3h, olc

Details for d6exsa_

PDB Entry: 6exs (more details), 2.5 Å

PDB Description: crystal structure of a pot family transporter in complex with thioalcohol conjugated peptide.
PDB Compounds: (A:) Peptide ABC transporter permease

SCOPe Domain Sequences for d6exsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6exsa_ f.38.1.0 (A:) automated matches {Staphylococcus hominis [TaxId: 1290]}
qtiqsipqkgffghprglgvlffvefwerfsyygmramlifymyfaihqnglgidkttam
simsvygaliymssipgawiadritgtrgatllgavliiighiclslpfalfglfssmff
iiigsglmkpnisnivgrlypendtridagfvifymsvnlgalispiilqhfvdirnfhg
gfllaaigmalglvwyllfnrknlgsvgmaptnplskeekrkygmiigiivaivivvllv
tyythtlsfdlisntvlvlgvalpiiyfttmlrskdvtdgersrvkafiplfilgmlfws
iqeqgsnvlniyglersdmqlnlfgwttrfgealfqsinplfillfapvismiwlkmgkk
qpslaikfsigtllaglsyiliglvglgyghtqfsvnwvilsyvicvigelclsptgnsa
avklapkafnaqmmsvwlltnasaqaingtlvklikplgqtnyfiflgtvaivitliilv
fspkitk

SCOPe Domain Coordinates for d6exsa_:

Click to download the PDB-style file with coordinates for d6exsa_.
(The format of our PDB-style files is described here.)

Timeline for d6exsa_: