![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.83: Aconitase iron-sulfur domain [53731] (1 superfamily) consists of three similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.83.1: Aconitase iron-sulfur domain [53732] (1 family) ![]() |
![]() | Family c.83.1.1: Aconitase iron-sulfur domain [53733] (4 proteins) duplication: consists of three structurally similar subdomains with subdomains 1 and 3 being related by pseudo twofold symmetry |
![]() | Protein Aconitase A, N-terminal domain [53734] (2 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [53736] (9 PDB entries) |
![]() | Domain d8acna2: 8acn A:2-528 [35400] Other proteins in same PDB: d8acna1 complexed with nic, sf4 |
PDB Entry: 8acn (more details), 2 Å
SCOPe Domain Sequences for d8acna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d8acna2 c.83.1.1 (A:2-528) Aconitase A, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} rakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkty lrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdinq evynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicigv ggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaiveyh gpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlvp dsgchydqlieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctns syedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlanac gpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkfn petdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqr
Timeline for d8acna2: