Lineage for d8acn_2 (8acn 2-528)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27688Fold c.83: Aconitase, first 3 domains [53731] (1 superfamily)
  4. 27689Superfamily c.83.1: Aconitase, first 3 domains [53732] (1 family) (S)
  5. 27690Family c.83.1.1: Aconitase, first 3 domains [53733] (1 protein)
  6. 27691Protein Aconitase, first 3 domains [53734] (2 species)
  7. 27692Species Cow (Bos taurus) [TaxId:9913] [53736] (9 PDB entries)
  8. 27694Domain d8acn_2: 8acn 2-528 [35400]
    Other proteins in same PDB: d8acn_1

Details for d8acn_2

PDB Entry: 8acn (more details), 2 Å

PDB Description: crystal structures of aconitase with isocitrate and nitroisocitrate bound

SCOP Domain Sequences for d8acn_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d8acn_2 c.83.1.1 (2-528) Aconitase, first 3 domains {Cow (Bos taurus)}
rakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkty
lrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdinq
evynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicigv
ggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaiveyh
gpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlvp
dsgchydqlieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctns
syedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlanac
gpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkfn
petdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqr

SCOP Domain Coordinates for d8acn_2:

Click to download the PDB-style file with coordinates for d8acn_2.
(The format of our PDB-style files is described here.)

Timeline for d8acn_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d8acn_1