SCOPe 2.07: Domain d5oyac2: 5oya C:154-483

Lineage for d5oyac2 (5oya C:154-483)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families)
   automatically mapped to Pfam PF00016

5. Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
   N-terminal domain is alpha+beta

6. Protein automated matches [226984] (16 species)
   not a true protein

7. Species Chaetoceros socialis [TaxId:163503] [353964] (1 PDB entry)

8. Domain d5oyac2: 5oya C:154-483 [353990]
   Other proteins in same PDB: d5oyaa1, d5oyab1, d5oyac1, d5oyad1, d5oyae1, d5oyaf1, d5oyag1, d5oyah1, d5oyai_, d5oyaj_, d5oyak_, d5oyal_, d5oyam_, d5oyan_, d5oyao_, d5oyap_
   automated match to d1bwva1
   complexed with cap, edo, mg

Details for d5oyac2

PDB Entry: 5oya, 1.8 Å

PDB Description: unusual posttranslational modifications revealed in crystal structures of diatom rubisco.

PDB Compounds: (C:) Rubisco large subunit

SCOPe Domain Sequences for d5oyac2:

Sequence; same for both SEQRES and ATOM records:

>d5oyac2 c.1.14.1 (C:154-483) automated matches {Chaetoceros socialis [TaxId: 163503]}
gpatgiivererlnkygtplxgatvkpklglsgknygrvvyeglkggldflkddeninsq
pfmrwrerflncleginrasaatgevkgsylnvtaatmeevykraeyakaigsivvmidl
vmgytaiqsiaywarendmllhlhragnstyarqknhginfrvickwmrmsgvdhihagt
vvgklegdplmikgfydilrltelevnlpfgiffemdwaslrrcmpvasggihcgqmhql
ihylgddvvlqfgggtighpdgiqagatanrvaleamvlarnegadyfnnqvgpqilrda
aktcgplqtaldlwkdisfnytstdtadfs

Timeline for d5oyac2:

• d5oyac2 is new in SCOPe 2.07-stable
  
• d5oyac2 appears in the current release, SCOPe 2.08