Lineage for d1acoa2 (1aco A:2-528)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2141742Fold c.83: Aconitase iron-sulfur domain [53731] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2141743Superfamily c.83.1: Aconitase iron-sulfur domain [53732] (1 family) (S)
  5. 2141744Family c.83.1.1: Aconitase iron-sulfur domain [53733] (4 protein domains)
    duplication: consists of three structurally similar subdomains with subdomains 1 and 3 being related by pseudo twofold symmetry
  6. 2141745Protein Aconitase A, N-terminal domain [53734] (2 species)
  7. 2141746Species Cow (Bos taurus) [TaxId:9913] [53736] (9 PDB entries)
  8. 2141748Domain d1acoa2: 1aco A:2-528 [35399]
    Other proteins in same PDB: d1acoa1
    complexed with sf4, tra

Details for d1acoa2

PDB Entry: 1aco (more details), 2.05 Å

PDB Description: crystal structure of aconitase with transaconitate bound
PDB Compounds: (A:) aconitase

SCOPe Domain Sequences for d1acoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1acoa2 c.83.1.1 (A:2-528) Aconitase A, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
rakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkty
lrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdinq
evynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicigv
ggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaiveyh
gpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlvp
dsgchydqlieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctns
syedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlanac
gpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkfn
petdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqr

SCOPe Domain Coordinates for d1acoa2:

Click to download the PDB-style file with coordinates for d1acoa2.
(The format of our PDB-style files is described here.)

Timeline for d1acoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1acoa1