Lineage for d5oyai_ (5oya I:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2564397Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2564398Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2564681Family d.73.1.0: automated matches [336551] (1 protein)
    not a true family
  6. 2564682Protein automated matches [336552] (9 species)
    not a true protein
  7. 2564683Species Chaetoceros socialis [TaxId:163503] [353971] (1 PDB entry)
  8. 2564684Domain d5oyai_: 5oya I: [353984]
    Other proteins in same PDB: d5oyaa1, d5oyaa2, d5oyab1, d5oyab2, d5oyac1, d5oyac2, d5oyad1, d5oyad2, d5oyae1, d5oyae2, d5oyaf1, d5oyaf2, d5oyag1, d5oyag2, d5oyah1, d5oyah2
    automated match to d1iwab_
    complexed with cap, edo, mg

Details for d5oyai_

PDB Entry: 5oya (more details), 1.8 Å

PDB Description: unusual posttranslational modifications revealed in crystal structures of diatom rubisco.
PDB Compounds: (I:) Rubisco small subunit

SCOPe Domain Sequences for d5oyai_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oyai_ d.73.1.0 (I:) automated matches {Chaetoceros socialis [TaxId: 163503]}
mrltqgcfsflpdltdaqiekqvayamsrgwamnvewtddphprnnywelwglplfdikd
patvmfelnearkscaagyirmnafdasygtescvmsfltnrpanepgfyldrtdgigrq
iiysiksysvqanpegsry

SCOPe Domain Coordinates for d5oyai_:

Click to download the PDB-style file with coordinates for d5oyai_.
(The format of our PDB-style files is described here.)

Timeline for d5oyai_: