Lineage for d6br1f2 (6br1 F:77-378)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541719Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
    Pfam PF03133; PubMed 22020298
  6. 2541720Protein Tubulin tyrosine ligase (TTL) C-terminal domain [310728] (3 species)
  7. 2541721Species Chicken (Gallus gallus) [TaxId:9031] [311385] (79 PDB entries)
  8. 3053905Domain d6br1f2: 6br1 F:77-378 [353967]
    Other proteins in same PDB: d6br1a1, d6br1a2, d6br1b1, d6br1b2, d6br1c1, d6br1c2, d6br1d1, d6br1d2, d6br1e_, d6br1f1, d6br1f3
    automated match to d3tiia2
    complexed with acp, ca, e3y, gdp, gtp, mes, mg

Details for d6br1f2

PDB Entry: 6br1 (more details), 2.3 Å

PDB Description: tubulin-rb3_sld-ttl in complex with heterocyclic pyrimidine compound 4a
PDB Compounds: (F:) tubulin tyrosine ligase

SCOPe Domain Sequences for d6br1f2:

Sequence, based on SEQRES records: (download)

>d6br1f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d6br1f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptrevflaaynrrregregnvwialisseaselld
fideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregvlrtssepynsa
nfqdktchltnhciqknygryeegnemffeefnqylmdalnttlensillqikhiirscl
mciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaqklyaelcqgivdvai
ssvfplatsifikl

SCOPe Domain Coordinates for d6br1f2:

Click to download the PDB-style file with coordinates for d6br1f2.
(The format of our PDB-style files is described here.)

Timeline for d6br1f2:

  • d6br1f2 appears in periodic updates to SCOPe 2.07 starting on 2018-06-28