Lineage for d1b0ka2 (1b0k A:2-528)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74791Fold c.83: Aconitase, first 3 domains [53731] (1 superfamily)
  4. 74792Superfamily c.83.1: Aconitase, first 3 domains [53732] (1 family) (S)
  5. 74793Family c.83.1.1: Aconitase, first 3 domains [53733] (1 protein)
  6. 74794Protein Aconitase, first 3 domains [53734] (2 species)
  7. 74805Species Pig (Sus scrofa) [TaxId:9823] [53735] (6 PDB entries)
  8. 74809Domain d1b0ka2: 1b0k A:2-528 [35396]
    Other proteins in same PDB: d1b0ka1

Details for d1b0ka2

PDB Entry: 1b0k (more details), 2.5 Å

PDB Description: s642a:fluorocitrate complex of aconitase

SCOP Domain Sequences for d1b0ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b0ka2 c.83.1.1 (A:2-528) Aconitase, first 3 domains {Pig (Sus scrofa)}
rakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkty
lrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdinq
evynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicigv
ggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaiveyh
gpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlvp
dpgchydqvieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctns
syedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlanac
gpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkfn
petdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqr

SCOP Domain Coordinates for d1b0ka2:

Click to download the PDB-style file with coordinates for d1b0ka2.
(The format of our PDB-style files is described here.)

Timeline for d1b0ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b0ka1